[Update on Realtime Private or Group message] Apart from receiving instant reply from members via Private or Group Message. You are now able to see if who are online and currently viewing the conversation. More info here
Welcome to the New and Upgraded Pinoy AU Forum! We have only updated a couple of times since 2010. Apology it took some time. Some of the features are still being migrated. Please feel free to report here or email me at [email protected] if you will encounter any issues. Thank you.

Electricity, Gas and Water Bill - pls share how much you are paying per month...

TasBurrfootTasBurrfoot OsakaPosts: 4,336Member
edited May 2013 in Other Info Bout OZ
Hi guys, please share how much you are paying for Electricity, Gas and Water... Also, if you can share your provider.

We are currently awaiting for our first bill...

Primary Applicant: Wife
Accountant (General): 221111

04 Aug 2012 - IELTS (Academic Module)
07 Aug 2012 - IELTS (Academic Module) Speaking Part
17 Aug 2012 - IELTS Results (L: 8.5 R: 8.5 W: 7.0 S: 7.5 OBS: 8.0)
24 Aug 2012 - CPAA Submitted (docs mailed same day via SG EMS)
25 Sep 2012 - Received +Skills Assessment from CPAA
25 Sep 2012 - Lodged EOI Application with 70pts
30 Sep 2012 - Invited by DIAC to apply for 189 Visa
01 Oct 2012 - Submitted 189 Visa Application
20 Oct 2012 - Medical Examinations
23 Oct 2012 - CO Assigned; Team 7 - SA
05 Nov 2012 - Submitted SG PCC and NBI Clearance
06 Nov 2012 - Visa Granted (IED: 23/10/2013)
03 Apr 2013 - Flight to MEL
03 Jun 2013 - started work
12 Jun 2013 - wife started work
15 Jun 2016 - applied for citizenship
29 Jul 2016 - citizenship examination
20 Oct 2016 - Aussie, Aussie, Aussie Oi Oi Oi!!



  • nfrondanfronda PerthPosts: 816Member
    @psychoboy.. Our electricity bill during summer season ranges $600-700. Our house is a 3 bedroom house. But nung tag lamig our electricity bill ranges $300-400. Electricity bill nga pla is 2months yan.. Wla aqong idea sa water bill namin ksi ang owner ang nagbabayad.

    06-01-11: Arrived Australia (457 visa dependent on my dad)
    28-05-12: Lodged RSMS 857 visa (seperate from my dad already)
    28-06-12: Done Medical check
    30-10-12: Submit AFP check
    07-11-12: Went home on a bridging visa B for holiday and wedding..:)
    12-01-13: CO allocated and nomination approved
    18-01-13: CO asked documents of my husband to be included on my application as migrating dependent..Thank u LORD!
    15-02-13: Husband completed all requirements (police check, medical, english requirements and joint statement)
    15-02-13: CO issued pre-grant letter instructing hubby to apply tourist visa to enter Australia in order our 857 visa to be granted.
    27-02-13: Hubby applied Subclass 676 tourist visa.
    06-03-13: Hubby's tourist visa approved.
    16-03-13: Hubby arrived Australia.
    18-03-13: Our RSMS 857 visa granted.. (nothing to ask more)

  • TasBurrfootTasBurrfoot OsakaPosts: 4,336Member
    @psychoboy.. Our electricity bill during summer season ranges $600-700. Our house is a 3 bedroom house. But nung tag lamig our electricity bill ranges $300-400. Electricity bill nga pla is 2months yan.. Wla aqong idea sa water bill namin ksi ang owner ang nagbabayad.
    @nfronda, so it is like 300-350/month during summer and 150-200/month during winter?

    ehehehe, i thought it is more expensive during winter because of heater... :)

    thanks for sharing!!

    Primary Applicant: Wife
    Accountant (General): 221111

    04 Aug 2012 - IELTS (Academic Module)
    07 Aug 2012 - IELTS (Academic Module) Speaking Part
    17 Aug 2012 - IELTS Results (L: 8.5 R: 8.5 W: 7.0 S: 7.5 OBS: 8.0)
    24 Aug 2012 - CPAA Submitted (docs mailed same day via SG EMS)
    25 Sep 2012 - Received +Skills Assessment from CPAA
    25 Sep 2012 - Lodged EOI Application with 70pts
    30 Sep 2012 - Invited by DIAC to apply for 189 Visa
    01 Oct 2012 - Submitted 189 Visa Application
    20 Oct 2012 - Medical Examinations
    23 Oct 2012 - CO Assigned; Team 7 - SA
    05 Nov 2012 - Submitted SG PCC and NBI Clearance
    06 Nov 2012 - Visa Granted (IED: 23/10/2013)
    03 Apr 2013 - Flight to MEL
    03 Jun 2013 - started work
    12 Jun 2013 - wife started work
    15 Jun 2016 - applied for citizenship
    29 Jul 2016 - citizenship examination
    20 Oct 2016 - Aussie, Aussie, Aussie Oi Oi Oi!!

  • nfrondanfronda PerthPosts: 816Member
    @psychoboy..Ganun na nga.. Pag winter kasi, hndi namn masyadong malamig d2, so no need na ung heater..kaya mababa ang bill pag winter. Pag summer namn, sobrang init d2.. So ang aircon 24 hrs na umaandar kaya mataas bill pag summer.

    06-01-11: Arrived Australia (457 visa dependent on my dad)
    28-05-12: Lodged RSMS 857 visa (seperate from my dad already)
    28-06-12: Done Medical check
    30-10-12: Submit AFP check
    07-11-12: Went home on a bridging visa B for holiday and wedding..:)
    12-01-13: CO allocated and nomination approved
    18-01-13: CO asked documents of my husband to be included on my application as migrating dependent..Thank u LORD!
    15-02-13: Husband completed all requirements (police check, medical, english requirements and joint statement)
    15-02-13: CO issued pre-grant letter instructing hubby to apply tourist visa to enter Australia in order our 857 visa to be granted.
    27-02-13: Hubby applied Subclass 676 tourist visa.
    06-03-13: Hubby's tourist visa approved.
    16-03-13: Hubby arrived Australia.
    18-03-13: Our RSMS 857 visa granted.. (nothing to ask more)

  • NadineNadine BrisbanePosts: 481Member
    edited May 2013
    Hi guys, please share how much you are paying for Electricity, Gas and Water... Also, if you can share your provider.

    We are currently awaiting for our first bill...
    Hello psychoboy.

    Share ko yung sakin. 1-BR apartment, I don't share the apartment: Electricity 70; Gas 50.

    Take note, in the summer, virtually no aircon, no heater. While ngayon that it's hitting 8 deg C at sobrang lamig na, nonstop na yung airconditioning ko. You can't believe how cold it gets in the evenings!! I expect to see significant increase in my electricity. Gas doesn't change much coz I use hot water talaga for shower, washing dishes, etc, Kahit summer man yan or winter. Water is free.

    AGL for electricity. I would have wanted to use AGL for gas as well, pero wala pa sila connection samin. Origin for gas.

    21 Dec 2012 - 457 lodged
    7 Jan 2013 - medical finalised
    8 Jan 2013 - visa approved

  • AiwinkAiwink MelbournePosts: 199Member
    @psychoboy.. Our electricity bill during summer season ranges $600-700. Our house is a 3 bedroom house. But nung tag lamig our electricity bill ranges $300-400. Electricity bill nga pla is 2months yan.. Wla aqong idea sa water bill namin ksi ang owner ang nagbabayad.
    Every two months ba yung utility bills dito? Naghihintay pa Lang din kme ng first bill namin.... Yung water namin is owner din ang nagbabayad... Not that I'm complaining... Curious Lang Akko Kung bakit kaya....

    Here is my timeline with fees incurred :) 2012
    April 21- IELTS Passed (British Council Sg S$310)/ April-March -requirements for VETASSES, CTC 4 copies,DHL etc. (S$600)/March 19- Apply VETASSES online ($1150 aud)/June 06, 2012 - VETASSES (Architectural Draftsman) feedback positive /August 08- Apply EOI visa 190 at 70 points/September 11- Resubmit EOI (Was asked to change EOI form)/November 22- Apply for SS in WA (arch draftsman still available)/November 22- Resubmit EOI (changed the State from Victoria to WA)/December 05- Initial Contact by DIAC saying WA is interested./December 07- WA SS approved December 10- DIAC Invitation received (1 week down ecomm) December 14- Lodged Visa $3050aud (plus technical issues of ecom visa was "lodged" December 21 daw)/ Dec 28 - Medicals (frontload)/January 8 -CO Assigned/January 23-PCC/ JANUARY 23---VISA GRANT!!!!!!!!!!

  • TasBurrfootTasBurrfoot OsakaPosts: 4,336Member
    @psychoboy.. Our electricity bill during summer season ranges $600-700. Our house is a 3 bedroom house. But nung tag lamig our electricity bill ranges $300-400. Electricity bill nga pla is 2months yan.. Wla aqong idea sa water bill namin ksi ang owner ang nagbabayad.
    Every two months ba yung utility bills dito? Naghihintay pa Lang din kme ng first bill namin.... Yung water namin is owner din ang nagbabayad... Not that I'm complaining... Curious Lang Akko Kung bakit kaya....
    Every quarter ata @Aiwink... :)

    I just got our water bill; 3wks worth of usage came out at $14.14...

    Primary Applicant: Wife
    Accountant (General): 221111

    04 Aug 2012 - IELTS (Academic Module)
    07 Aug 2012 - IELTS (Academic Module) Speaking Part
    17 Aug 2012 - IELTS Results (L: 8.5 R: 8.5 W: 7.0 S: 7.5 OBS: 8.0)
    24 Aug 2012 - CPAA Submitted (docs mailed same day via SG EMS)
    25 Sep 2012 - Received +Skills Assessment from CPAA
    25 Sep 2012 - Lodged EOI Application with 70pts
    30 Sep 2012 - Invited by DIAC to apply for 189 Visa
    01 Oct 2012 - Submitted 189 Visa Application
    20 Oct 2012 - Medical Examinations
    23 Oct 2012 - CO Assigned; Team 7 - SA
    05 Nov 2012 - Submitted SG PCC and NBI Clearance
    06 Nov 2012 - Visa Granted (IED: 23/10/2013)
    03 Apr 2013 - Flight to MEL
    03 Jun 2013 - started work
    12 Jun 2013 - wife started work
    15 Jun 2016 - applied for citizenship
    29 Jul 2016 - citizenship examination
    20 Oct 2016 - Aussie, Aussie, Aussie Oi Oi Oi!!

  • AiwinkAiwink MelbournePosts: 199Member
    @psychoboy hmmmmm parang mura. PUB namin sa SG 400 every month.... tagal pala ng bills. heheh

    Here is my timeline with fees incurred :) 2012
    April 21- IELTS Passed (British Council Sg S$310)/ April-March -requirements for VETASSES, CTC 4 copies,DHL etc. (S$600)/March 19- Apply VETASSES online ($1150 aud)/June 06, 2012 - VETASSES (Architectural Draftsman) feedback positive /August 08- Apply EOI visa 190 at 70 points/September 11- Resubmit EOI (Was asked to change EOI form)/November 22- Apply for SS in WA (arch draftsman still available)/November 22- Resubmit EOI (changed the State from Victoria to WA)/December 05- Initial Contact by DIAC saying WA is interested./December 07- WA SS approved December 10- DIAC Invitation received (1 week down ecomm) December 14- Lodged Visa $3050aud (plus technical issues of ecom visa was "lodged" December 21 daw)/ Dec 28 - Medicals (frontload)/January 8 -CO Assigned/January 23-PCC/ JANUARY 23---VISA GRANT!!!!!!!!!!

  • TasBurrfootTasBurrfoot OsakaPosts: 4,336Member
    @psychoboy hmmmmm parang mura. PUB namin sa SG 400 every month.... tagal pala ng bills. heheh
    Wow, 400 per month is massive... Kami usually around 130 kami per month before; yun nga lang dalawa lang kami ni misis but in all fairness aircon all you want kami every night.

    Yung $14.14 ko, that is my water bill for 3 wks, naabutan na kasi ng cut-off... Wala pa diyan gas and electricity...

    Primary Applicant: Wife
    Accountant (General): 221111

    04 Aug 2012 - IELTS (Academic Module)
    07 Aug 2012 - IELTS (Academic Module) Speaking Part
    17 Aug 2012 - IELTS Results (L: 8.5 R: 8.5 W: 7.0 S: 7.5 OBS: 8.0)
    24 Aug 2012 - CPAA Submitted (docs mailed same day via SG EMS)
    25 Sep 2012 - Received +Skills Assessment from CPAA
    25 Sep 2012 - Lodged EOI Application with 70pts
    30 Sep 2012 - Invited by DIAC to apply for 189 Visa
    01 Oct 2012 - Submitted 189 Visa Application
    20 Oct 2012 - Medical Examinations
    23 Oct 2012 - CO Assigned; Team 7 - SA
    05 Nov 2012 - Submitted SG PCC and NBI Clearance
    06 Nov 2012 - Visa Granted (IED: 23/10/2013)
    03 Apr 2013 - Flight to MEL
    03 Jun 2013 - started work
    12 Jun 2013 - wife started work
    15 Jun 2016 - applied for citizenship
    29 Jul 2016 - citizenship examination
    20 Oct 2016 - Aussie, Aussie, Aussie Oi Oi Oi!!

  • TasBurrfootTasBurrfoot OsakaPosts: 4,336Member
    @psychoboy.. Our electricity bill during summer season ranges $600-700. Our house is a 3 bedroom house. But nung tag lamig our electricity bill ranges $300-400. Electricity bill nga pla is 2months yan.. Wla aqong idea sa water bill namin ksi ang owner ang nagbabayad.
    Every two months ba yung utility bills dito? Naghihintay pa Lang din kme ng first bill namin.... Yung water namin is owner din ang nagbabayad... Not that I'm complaining... Curious Lang Akko Kung bakit kaya....
    Every quarter ata @Aiwink... :)

    I just got our water bill; 3wks worth of usage came out at A$14.14...
    Revisiting this thread again since I started it... We just got our fist electric bill from Origin; we will be paying $75 for 45 days of usage with average daily consumption of 2.16kWh - take note, this is just basic lights, fridge and washing machine plus iphone/laptop charging and wifi modem. wala kami TV, dryer and non-usage of the heater here.

    I would say mahal sya, S$130 kami sa Singapore before and this included daily aircon of roughly 8hrs/day, ps3, TV, washing machine, water and gas consumption.

    Just have to get use to this kind of pricing I guess... :D

    Primary Applicant: Wife
    Accountant (General): 221111

    04 Aug 2012 - IELTS (Academic Module)
    07 Aug 2012 - IELTS (Academic Module) Speaking Part
    17 Aug 2012 - IELTS Results (L: 8.5 R: 8.5 W: 7.0 S: 7.5 OBS: 8.0)
    24 Aug 2012 - CPAA Submitted (docs mailed same day via SG EMS)
    25 Sep 2012 - Received +Skills Assessment from CPAA
    25 Sep 2012 - Lodged EOI Application with 70pts
    30 Sep 2012 - Invited by DIAC to apply for 189 Visa
    01 Oct 2012 - Submitted 189 Visa Application
    20 Oct 2012 - Medical Examinations
    23 Oct 2012 - CO Assigned; Team 7 - SA
    05 Nov 2012 - Submitted SG PCC and NBI Clearance
    06 Nov 2012 - Visa Granted (IED: 23/10/2013)
    03 Apr 2013 - Flight to MEL
    03 Jun 2013 - started work
    12 Jun 2013 - wife started work
    15 Jun 2016 - applied for citizenship
    29 Jul 2016 - citizenship examination
    20 Oct 2016 - Aussie, Aussie, Aussie Oi Oi Oi!!

  • NadineNadine BrisbanePosts: 481Member
    Namamahalan ako sa Origin sa totoo lang. Kung pwede nga lang transfer to AGL yung gas ko eh.

    21 Dec 2012 - 457 lodged
    7 Jan 2013 - medical finalised
    8 Jan 2013 - visa approved

  • TasBurrfootTasBurrfoot OsakaPosts: 4,336Member
    Namamahalan ako sa Origin sa totoo lang. Kung pwede nga lang transfer to AGL yung gas ko eh.
    Ehehehe, I dunno sa iba and I don't have any basis of comparison kasi BUT I find it ridiculous na may daily connection fee amounting to around a dollar - IMAGINE sa bill ko for 45 days, I paid $30 lang for electricity, the rest ($45) is for the connection fee (or whatever you call it...)

    Darn!! :)

    Primary Applicant: Wife
    Accountant (General): 221111

    04 Aug 2012 - IELTS (Academic Module)
    07 Aug 2012 - IELTS (Academic Module) Speaking Part
    17 Aug 2012 - IELTS Results (L: 8.5 R: 8.5 W: 7.0 S: 7.5 OBS: 8.0)
    24 Aug 2012 - CPAA Submitted (docs mailed same day via SG EMS)
    25 Sep 2012 - Received +Skills Assessment from CPAA
    25 Sep 2012 - Lodged EOI Application with 70pts
    30 Sep 2012 - Invited by DIAC to apply for 189 Visa
    01 Oct 2012 - Submitted 189 Visa Application
    20 Oct 2012 - Medical Examinations
    23 Oct 2012 - CO Assigned; Team 7 - SA
    05 Nov 2012 - Submitted SG PCC and NBI Clearance
    06 Nov 2012 - Visa Granted (IED: 23/10/2013)
    03 Apr 2013 - Flight to MEL
    03 Jun 2013 - started work
    12 Jun 2013 - wife started work
    15 Jun 2016 - applied for citizenship
    29 Jul 2016 - citizenship examination
    20 Oct 2016 - Aussie, Aussie, Aussie Oi Oi Oi!!

  • icebreaker1928icebreaker1928 SydneyPosts: 1,446Member
    edited June 2013
    sana gumamit ka yung ng comparison website...
    may ginamit ako dating comparison na website ng government ng AU.
    Sorry nakalimutan ko url :D

    Base doon sa result, AGL ang pinaka cheapest sa area namin.
    per area iba ang result. I believe hindi naman sya bias kasi government website sya.

    Ano yang connection fee na yan? parang wala AGL nyan.
    Ang dami pang discount nung nag-apply ako kelangan ko nga lang mag lock-in sa kanila for 2years.

    First billing ko may discount akong $100.
    Pag on time ang bayad may discount.
    Pag direct debit may 2% discount.
    At kung anong anek anek pa.

    Check AGL website or better yet, use a comparison website para alam nyo cheapest sa area nyo.

    So my bill for more than 3months use is $171 less $100 so $71 na lang, not bad na rin.
  • TasBurrfootTasBurrfoot OsakaPosts: 4,336Member
    Ano yang connection fee na yan? parang wala AGL nyan.
    Ang dami pang discount nung nag-apply ako kelangan ko nga lang mag lock-in sa kanila for 2years.

    First billing ko may discount akong $100.
    Pag on time ang bayad may discount.
    Pag direct debit may 2% discount.
    At kung anong anek anek pa.

    Check AGL website or better yet, use a comparison website para alam nyo cheapest sa area nyo.

    So my bill for more than 3months use is $171 less $100 so $71 na lang, not bad na rin.
    They call it service charge and from my statement, it is costing me $1.02 per day...

    $171 bill mo, if you don't mind may I know details ng house ninyo (i.e. ilan kayo, ano usage ninyo...)

    Thanks boss @icebreaker1928

    Primary Applicant: Wife
    Accountant (General): 221111

    04 Aug 2012 - IELTS (Academic Module)
    07 Aug 2012 - IELTS (Academic Module) Speaking Part
    17 Aug 2012 - IELTS Results (L: 8.5 R: 8.5 W: 7.0 S: 7.5 OBS: 8.0)
    24 Aug 2012 - CPAA Submitted (docs mailed same day via SG EMS)
    25 Sep 2012 - Received +Skills Assessment from CPAA
    25 Sep 2012 - Lodged EOI Application with 70pts
    30 Sep 2012 - Invited by DIAC to apply for 189 Visa
    01 Oct 2012 - Submitted 189 Visa Application
    20 Oct 2012 - Medical Examinations
    23 Oct 2012 - CO Assigned; Team 7 - SA
    05 Nov 2012 - Submitted SG PCC and NBI Clearance
    06 Nov 2012 - Visa Granted (IED: 23/10/2013)
    03 Apr 2013 - Flight to MEL
    03 Jun 2013 - started work
    12 Jun 2013 - wife started work
    15 Jun 2016 - applied for citizenship
    29 Jul 2016 - citizenship examination
    20 Oct 2016 - Aussie, Aussie, Aussie Oi Oi Oi!!

  • icebreaker1928icebreaker1928 SydneyPosts: 1,446Member
    @psychoboy 3 kami sir... mag-ina ko naiwan sa bahay...
    2 laptop, ref, washing machine, tablet, 2phone, 1 landline, hot shower (babad ako dito sa umaga pantangal ng lamig :D) ... wala kami tv..
    hindi pa kami nagamit ng a/c at heater nun...
    malamang ngayon magkakaalaman dahil winter hahaha..

    wala akong makitang service charge sa billing ko e..

    ito nakalagay sa billing ko

    Usage and supply charges $169.32
    Credits and rebates $117.84cr
    Total GST for newcharges $5.15
    Total amount due $71.11
  • TasBurrfootTasBurrfoot OsakaPosts: 4,336Member
    @psychoboy 3 kami sir... mag-ina ko naiwan sa bahay...
    2 laptop, ref, washing machine, tablet, 2phone, 1 landline, hot shower (babad ako dito sa umaga pantangal ng lamig :D) ... wala kami tv..
    hindi pa kami nagamit ng a/c at heater nun...
    malamang ngayon magkakaalaman dahil winter hahaha..

    wala akong makitang service charge sa billing ko e..

    ito nakalagay sa billing ko

    Usage and supply charges $169.32
    Credits and rebates $117.84cr
    Total GST for newcharges $5.15
    Total amount due $71.11
    Supply charge cguro sa inyo Sir... :)

    More or less parehas lang tayo ng usage!! Ehehehe... :)

    Oo, favorite libangan ko dito ang maligo... Dahil sa winter!! lolz...

    Primary Applicant: Wife
    Accountant (General): 221111

    04 Aug 2012 - IELTS (Academic Module)
    07 Aug 2012 - IELTS (Academic Module) Speaking Part
    17 Aug 2012 - IELTS Results (L: 8.5 R: 8.5 W: 7.0 S: 7.5 OBS: 8.0)
    24 Aug 2012 - CPAA Submitted (docs mailed same day via SG EMS)
    25 Sep 2012 - Received +Skills Assessment from CPAA
    25 Sep 2012 - Lodged EOI Application with 70pts
    30 Sep 2012 - Invited by DIAC to apply for 189 Visa
    01 Oct 2012 - Submitted 189 Visa Application
    20 Oct 2012 - Medical Examinations
    23 Oct 2012 - CO Assigned; Team 7 - SA
    05 Nov 2012 - Submitted SG PCC and NBI Clearance
    06 Nov 2012 - Visa Granted (IED: 23/10/2013)
    03 Apr 2013 - Flight to MEL
    03 Jun 2013 - started work
    12 Jun 2013 - wife started work
    15 Jun 2016 - applied for citizenship
    29 Jul 2016 - citizenship examination
    20 Oct 2016 - Aussie, Aussie, Aussie Oi Oi Oi!!

  • LittleBoyBlueLittleBoyBlue North RydePosts: 334Member
    mga $100 ako per month sa gas, same price sa electricity, yung water ko libre at sa flat lang ako nakatira. +/- $20 lang usually, and as you know, quarterly ang bayad.

    ICT Business Analyst - Visa 189 Granted Oct 2012

  • icebreaker1928icebreaker1928 SydneyPosts: 1,446Member

    nakita ko na yung supply charge...

    Usage and supply charges
    Peak 452 [email protected] $0.2440 $110.29
    Supply Charge $59.03
    Total usage and supply charges $169.32

    ito nga pala yung mga discounts and rebates sa AGL
    10% Guaranteed PeakDiscount
    2% Direct Debit Discount
    5% Pay On Time Discount

    mga kaforum, hindi ko sinasabi na mura ang AGL ha, nagkataon lang sa area namin sya mura... kaya mas maganda talaga iresearch kung anong mura sa area nyo...

    cheers :)
  • kremitzkremitz North RydePosts: 1,074Member
    @TasBurFoot diba you have 1 kid din?how much usually yung monthly expenses nyo?rent, food, bills etc. are you From sydney?

    Occupation: Software Engineer (ANZSCO Code 261313)
    Main applicant : Husband
    April 29, 2013 : ACS Skills assessment
    July 22, 2013 : ACS assessment result
    January 3, 2014: IELTS Result (Take 1 L-8,W,R,S-7)
    January 12, 2013: Lodged EOI (65points)
    January 13, 2013: Invited to apply for visa 189
    February 9, 2014: Lodged visa
    March 1, 2014: Medicals at NHSI
    March 6: email from CO requesting form 80 and hubby's NBI Clearance
    March 25, 2014: visa grant. Thank you lord
    June 8,2014: Hubby arrived in Sydney
    Sept 11,2014: Hubby's first day of work. Thank you Lord!
    Feb 7, 2015 : Baby and I arrived in Sydney
    April 13, 2015: My first day of work :)

  • jengratajengrata SydneyPosts: 527Member
    @icebreaker1928 sorry kung paulit ulit, confirm ko lang ung 171 na bill nyo is for 3months? So it was like 57 per month? Tapos family of 3 kayo? Ano pong nirerent nyo? Like how many bedrooms? Kasi family of 3 din kami eh. Salamat po sa paliwanag in advance :)

    ANZSCO code 263111: Computer Network and System Engineer
    April 11, 2013 - lodge 189 visa - 75pts
    April 19, 2013 - CO allocated, Brisbane Team33
    May 6, 2013 - Medical submitted by SATA
    May 15, 2013 - uploaded NBI, SG PCC and Form 80
    June 19, 2013 - Visa Granted. Thank you Lord!
    September 2013 - Hubby got a Job (while we are still in SG)
    October 2013 - Flight to Brisbane

  • TasBurrfootTasBurrfoot OsakaPosts: 4,336Member
    @TasBurFoot diba you have 1 kid din?how much usually yung monthly expenses nyo?rent, food, bills etc. are you From sydney?
    Mali ka sa dalawa boss @kremitz - I don't have a kid (but I have a wife) and I don't live in Sydney... :)

    We try to make do with $2500 per month pero ngayon since bago pa kami, every now and then may mga big ticket items na binibili pero yung regular expense nakakaya naman namin sa amount na iyon.

    Primary Applicant: Wife
    Accountant (General): 221111

    04 Aug 2012 - IELTS (Academic Module)
    07 Aug 2012 - IELTS (Academic Module) Speaking Part
    17 Aug 2012 - IELTS Results (L: 8.5 R: 8.5 W: 7.0 S: 7.5 OBS: 8.0)
    24 Aug 2012 - CPAA Submitted (docs mailed same day via SG EMS)
    25 Sep 2012 - Received +Skills Assessment from CPAA
    25 Sep 2012 - Lodged EOI Application with 70pts
    30 Sep 2012 - Invited by DIAC to apply for 189 Visa
    01 Oct 2012 - Submitted 189 Visa Application
    20 Oct 2012 - Medical Examinations
    23 Oct 2012 - CO Assigned; Team 7 - SA
    05 Nov 2012 - Submitted SG PCC and NBI Clearance
    06 Nov 2012 - Visa Granted (IED: 23/10/2013)
    03 Apr 2013 - Flight to MEL
    03 Jun 2013 - started work
    12 Jun 2013 - wife started work
    15 Jun 2016 - applied for citizenship
    29 Jul 2016 - citizenship examination
    20 Oct 2016 - Aussie, Aussie, Aussie Oi Oi Oi!!

  • kremitzkremitz North RydePosts: 1,074Member
    Ay sorry @TasBurrFoot. Onga pla sa melbourne ka nga pala. Do you rent a house ba?ano po ba pag flat share?ypu share the same house tapos may kanya kanyang rooms? Normally how much would that cost?since i know rent talaga ang mahal sa oz. thanks ha

    Occupation: Software Engineer (ANZSCO Code 261313)
    Main applicant : Husband
    April 29, 2013 : ACS Skills assessment
    July 22, 2013 : ACS assessment result
    January 3, 2014: IELTS Result (Take 1 L-8,W,R,S-7)
    January 12, 2013: Lodged EOI (65points)
    January 13, 2013: Invited to apply for visa 189
    February 9, 2014: Lodged visa
    March 1, 2014: Medicals at NHSI
    March 6: email from CO requesting form 80 and hubby's NBI Clearance
    March 25, 2014: visa grant. Thank you lord
    June 8,2014: Hubby arrived in Sydney
    Sept 11,2014: Hubby's first day of work. Thank you Lord!
    Feb 7, 2015 : Baby and I arrived in Sydney
    April 13, 2015: My first day of work :)

  • kremitzkremitz North RydePosts: 1,074Member
    For a family f three how much usually monthly expenses? I'm thinking lang baka mahirap if isa lang nagwwork if may baby pa

    Occupation: Software Engineer (ANZSCO Code 261313)
    Main applicant : Husband
    April 29, 2013 : ACS Skills assessment
    July 22, 2013 : ACS assessment result
    January 3, 2014: IELTS Result (Take 1 L-8,W,R,S-7)
    January 12, 2013: Lodged EOI (65points)
    January 13, 2013: Invited to apply for visa 189
    February 9, 2014: Lodged visa
    March 1, 2014: Medicals at NHSI
    March 6: email from CO requesting form 80 and hubby's NBI Clearance
    March 25, 2014: visa grant. Thank you lord
    June 8,2014: Hubby arrived in Sydney
    Sept 11,2014: Hubby's first day of work. Thank you Lord!
    Feb 7, 2015 : Baby and I arrived in Sydney
    April 13, 2015: My first day of work :)

  • jengratajengrata SydneyPosts: 527Member
    @kremitz family of 3 ka din? Pareho pala tayo ng mga questions at nireresearch. Hehehe.

    ANZSCO code 263111: Computer Network and System Engineer
    April 11, 2013 - lodge 189 visa - 75pts
    April 19, 2013 - CO allocated, Brisbane Team33
    May 6, 2013 - Medical submitted by SATA
    May 15, 2013 - uploaded NBI, SG PCC and Form 80
    June 19, 2013 - Visa Granted. Thank you Lord!
    September 2013 - Hubby got a Job (while we are still in SG)
    October 2013 - Flight to Brisbane

  • TasBurrfootTasBurrfoot OsakaPosts: 4,336Member
    Ay sorry @TasBurrFoot. Onga pla sa melbourne ka nga pala. Do you rent a house ba?ano po ba pag flat share?ypu share the same house tapos may kanya kanyang rooms? Normally how much would that cost?since i know rent talaga ang mahal sa oz. thanks ha
    Yup, me and my wife are renting our own 2-bed house... :)

    Rental cost varies mate; it varies differently; http://www.domain.com.au will give you an idea of how much would be the damage for such.

    Primary Applicant: Wife
    Accountant (General): 221111

    04 Aug 2012 - IELTS (Academic Module)
    07 Aug 2012 - IELTS (Academic Module) Speaking Part
    17 Aug 2012 - IELTS Results (L: 8.5 R: 8.5 W: 7.0 S: 7.5 OBS: 8.0)
    24 Aug 2012 - CPAA Submitted (docs mailed same day via SG EMS)
    25 Sep 2012 - Received +Skills Assessment from CPAA
    25 Sep 2012 - Lodged EOI Application with 70pts
    30 Sep 2012 - Invited by DIAC to apply for 189 Visa
    01 Oct 2012 - Submitted 189 Visa Application
    20 Oct 2012 - Medical Examinations
    23 Oct 2012 - CO Assigned; Team 7 - SA
    05 Nov 2012 - Submitted SG PCC and NBI Clearance
    06 Nov 2012 - Visa Granted (IED: 23/10/2013)
    03 Apr 2013 - Flight to MEL
    03 Jun 2013 - started work
    12 Jun 2013 - wife started work
    15 Jun 2016 - applied for citizenship
    29 Jul 2016 - citizenship examination
    20 Oct 2016 - Aussie, Aussie, Aussie Oi Oi Oi!!

  • kremitzkremitz North RydePosts: 1,074Member
    @jengrata we'll be having a baby this sept kaya research2 lang ng mga expenses if ever hehe though waitingpalang kami for acs result. Tsaka ipon din pangbaon though most likely mauuna husband ko para di masyado magastos. Saang state kayo sis?how old na kid mo?are you planning to work ba kagad?

    Occupation: Software Engineer (ANZSCO Code 261313)
    Main applicant : Husband
    April 29, 2013 : ACS Skills assessment
    July 22, 2013 : ACS assessment result
    January 3, 2014: IELTS Result (Take 1 L-8,W,R,S-7)
    January 12, 2013: Lodged EOI (65points)
    January 13, 2013: Invited to apply for visa 189
    February 9, 2014: Lodged visa
    March 1, 2014: Medicals at NHSI
    March 6: email from CO requesting form 80 and hubby's NBI Clearance
    March 25, 2014: visa grant. Thank you lord
    June 8,2014: Hubby arrived in Sydney
    Sept 11,2014: Hubby's first day of work. Thank you Lord!
    Feb 7, 2015 : Baby and I arrived in Sydney
    April 13, 2015: My first day of work :)

  • kremitzkremitz North RydePosts: 1,074Member
    Thanks @TasBurrfoot. Pero usually ba pag mayfamily na mahirapan maki share sa house?mas tipid kasi pag may kashare eh :)

    Occupation: Software Engineer (ANZSCO Code 261313)
    Main applicant : Husband
    April 29, 2013 : ACS Skills assessment
    July 22, 2013 : ACS assessment result
    January 3, 2014: IELTS Result (Take 1 L-8,W,R,S-7)
    January 12, 2013: Lodged EOI (65points)
    January 13, 2013: Invited to apply for visa 189
    February 9, 2014: Lodged visa
    March 1, 2014: Medicals at NHSI
    March 6: email from CO requesting form 80 and hubby's NBI Clearance
    March 25, 2014: visa grant. Thank you lord
    June 8,2014: Hubby arrived in Sydney
    Sept 11,2014: Hubby's first day of work. Thank you Lord!
    Feb 7, 2015 : Baby and I arrived in Sydney
    April 13, 2015: My first day of work :)

  • TasBurrfootTasBurrfoot OsakaPosts: 4,336Member
    Thanks @TasBurrfoot. Pero usually ba pag mayfamily na mahirapan maki share sa house?mas tipid kasi pag may kashare eh :)
    Put it this way, ako personally I would not want to share a house with a family... :) Okey lang cguro if 1 individual lang.

    I really dunno mate...

    Primary Applicant: Wife
    Accountant (General): 221111

    04 Aug 2012 - IELTS (Academic Module)
    07 Aug 2012 - IELTS (Academic Module) Speaking Part
    17 Aug 2012 - IELTS Results (L: 8.5 R: 8.5 W: 7.0 S: 7.5 OBS: 8.0)
    24 Aug 2012 - CPAA Submitted (docs mailed same day via SG EMS)
    25 Sep 2012 - Received +Skills Assessment from CPAA
    25 Sep 2012 - Lodged EOI Application with 70pts
    30 Sep 2012 - Invited by DIAC to apply for 189 Visa
    01 Oct 2012 - Submitted 189 Visa Application
    20 Oct 2012 - Medical Examinations
    23 Oct 2012 - CO Assigned; Team 7 - SA
    05 Nov 2012 - Submitted SG PCC and NBI Clearance
    06 Nov 2012 - Visa Granted (IED: 23/10/2013)
    03 Apr 2013 - Flight to MEL
    03 Jun 2013 - started work
    12 Jun 2013 - wife started work
    15 Jun 2016 - applied for citizenship
    29 Jul 2016 - citizenship examination
    20 Oct 2016 - Aussie, Aussie, Aussie Oi Oi Oi!!

  • jengratajengrata SydneyPosts: 527Member
    @TasBurrfoot aha! Youve changed your name. Hihihi. Yes you have a point. Its better to share with individuals than family. Lalo na with kids. Its hard to divide and justify expenses like pub amongst household members. Meron naman 1BR apartments na affordable, i guess @kremitz

    ANZSCO code 263111: Computer Network and System Engineer
    April 11, 2013 - lodge 189 visa - 75pts
    April 19, 2013 - CO allocated, Brisbane Team33
    May 6, 2013 - Medical submitted by SATA
    May 15, 2013 - uploaded NBI, SG PCC and Form 80
    June 19, 2013 - Visa Granted. Thank you Lord!
    September 2013 - Hubby got a Job (while we are still in SG)
    October 2013 - Flight to Brisbane

  • TasBurrfootTasBurrfoot OsakaPosts: 4,336Member
    @TasBurrfoot aha! Youve changed your name. Hihihi. Yes you have a point. Its better to share with individuals than family. Lalo na with kids. Its hard to divide and justify expenses like pub amongst household members. Meron naman 1BR apartments na affordable, i guess @kremitz
    @jengrata - it is just preference lang namin ni misis; we value our privacy kasi... :) Eh kung dala ang family, parang kami na yung nakikitira diba? Ehehehe!! :)

    Yep @kremitz, may 1 bedroom apartments naman...

    Primary Applicant: Wife
    Accountant (General): 221111

    04 Aug 2012 - IELTS (Academic Module)
    07 Aug 2012 - IELTS (Academic Module) Speaking Part
    17 Aug 2012 - IELTS Results (L: 8.5 R: 8.5 W: 7.0 S: 7.5 OBS: 8.0)
    24 Aug 2012 - CPAA Submitted (docs mailed same day via SG EMS)
    25 Sep 2012 - Received +Skills Assessment from CPAA
    25 Sep 2012 - Lodged EOI Application with 70pts
    30 Sep 2012 - Invited by DIAC to apply for 189 Visa
    01 Oct 2012 - Submitted 189 Visa Application
    20 Oct 2012 - Medical Examinations
    23 Oct 2012 - CO Assigned; Team 7 - SA
    05 Nov 2012 - Submitted SG PCC and NBI Clearance
    06 Nov 2012 - Visa Granted (IED: 23/10/2013)
    03 Apr 2013 - Flight to MEL
    03 Jun 2013 - started work
    12 Jun 2013 - wife started work
    15 Jun 2016 - applied for citizenship
    29 Jul 2016 - citizenship examination
    20 Oct 2016 - Aussie, Aussie, Aussie Oi Oi Oi!!

  • kremitzkremitz North RydePosts: 1,074Member
    Ah ok thanks sa suggestion. Onga naninibago ako.sanay ako psychoboy eh hehe

    Occupation: Software Engineer (ANZSCO Code 261313)
    Main applicant : Husband
    April 29, 2013 : ACS Skills assessment
    July 22, 2013 : ACS assessment result
    January 3, 2014: IELTS Result (Take 1 L-8,W,R,S-7)
    January 12, 2013: Lodged EOI (65points)
    January 13, 2013: Invited to apply for visa 189
    February 9, 2014: Lodged visa
    March 1, 2014: Medicals at NHSI
    March 6: email from CO requesting form 80 and hubby's NBI Clearance
    March 25, 2014: visa grant. Thank you lord
    June 8,2014: Hubby arrived in Sydney
    Sept 11,2014: Hubby's first day of work. Thank you Lord!
    Feb 7, 2015 : Baby and I arrived in Sydney
    April 13, 2015: My first day of work :)

Sign In or Register to comment.

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!


Random Members

Hezronrecardopinoisaudiboi8988iblessycardo suberiekxiaoluCORTESJAYJLEvaristonayabrayajpearlthefishthekneelawelynneislovelaurenceoliveralbaAybandanielTsiSenJuven1016rapsgalbertus1982arctmicsibulo
Browse Members

Members Online (15) + Guest (149)


Top Active Contributors

Top Posters